PAB20593

FAM172A antibody from Abnova Corporation
C5orf21, DKFZP564D172, Toupee

Antibody data

Product number
PAB20593
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20593, RRID:AB_10963103
Product name
FAM172A polyclonal antibody
Provider product page
Abnova Corporation - PAB20593
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FAM172A.
Antigen sequence
QIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPP
LDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYRE
DLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVS
IPVDATESEPKS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.