HPA012299

FAM172A antibody from Atlas Antibodies
C5orf21, DKFZP564D172, Toupee
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012299
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012299, RRID:AB_1845724
Product name
Anti-FAM172A
Provider product page
Atlas Antibodies - HPA012299
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPP
LDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYRE
DLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVS
IPVDATESEPKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -