HPA012299

FAM172A antibody from Atlas Antibodies
C5orf21, DKFZP564D172
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012299
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012299, RRID:AB_1233634
Product name
Anti-FAM172A
Provider product page
Atlas Antibodies - HPA012299
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPP
LDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYRE
DLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVS
IPVDATESEPKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -