HPA008009

BNIP1 antibody from Atlas Antibodies
Nip1, SEC20
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008009
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008009, RRID:AB_1078291
Product name
Anti-BNIP1
Provider product page
Atlas Antibodies - HPA008009
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
APQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPL
SALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKES
EKQLLLQE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -