HPA008009

BNIP1 antibody from Sigma-Aldrich
Nip1, SEC20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008009
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008009, RRID:AB_1078291
Product name
Anti-BNIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008009
Antibody type
Polyclonal
Antigen
Vesicle transport protein SEC20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPL
SALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKES
EKQLLLQE
Storage
-20C
Provider Type Product Number
- No reagents -