H00023759-B01

PPIL2 antibody from Abnova Corporation
CYC4, Cyp-60, UBOX7

Antibody data

Product number
H00023759-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023759-B01, RRID:AB_1204822
Product name
PPIL2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023759-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PPIL2 protein.
Antigen sequence
MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFR
RLPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWL
KKYGTNPSNGEKLDGRSLIKLNFSKNSEGKYHCPV
LFTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKN
FRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHV
KNNMKIIDPDEEKAKQDPSYYLKNTNAETRETLQE
LYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGK
VSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKG
YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHY
YDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPF
KDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFR
SCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTD
RPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKV
APETKVKSSQPQAGSQGPQTFRQGVGKYINPAATE
QQRKSPQPVPLSPCPRRSPVGVLGTSAPGSSRLPD
DH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -