Antibody data

Product number
ABIN503628
Provider
antibodies-online
Product name
anti-Kelch Domain Containing 2 (KLHDC2) antibody
Provider product page
antibodies-online - ABIN503628
Antibody type
Polyclonal
Antigen
The immunogen for anti-KLHDC2 antibody: synthetic peptide directed towards the N terminal of human KLHDC2
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host
Rabbit
Antigen sequence
VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYN
METGR WKKINTEGDV
Vial size
50 µg
Provider Type Product Number
- No reagents -