SAB2101280

KLHDC2 antibody from Sigma-Aldrich
HCLP-1, LCP
No application information provided.

Antibody data

Product number
SAB2101280
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2101280, RRID:AB_10607716
Product name
Anti-KLHDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2101280
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_055130.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VAVSDGRHMFVWGGYKSNQVRGLYDFYLPREELWI
YNMETGRWKKINTEG
Storage
-20C
Provider Type Product Number
- No reagents -