Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405025 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Nuclear Fragile X Mental Retardation Protein Interacting Protein 1 (NUFIP1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NUFIP1 antibody: synthetic peptide directed towards the N terminal of human NUFIP1
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNS
YYPRK YDAKFTDFSL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
Cell 2006 Nov 3;127(3):635-48
Cell 2006 Nov 3;127(3):635-48
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Host: Rabbit Target Name: NUFIP1 Sample Tissue: Human Fetal Muscle Antibody Dilution: 1.0 μg/mL