HPA007613

GALNT3 antibody from Sigma-Aldrich
GalNAc-T3, HFTC, HHS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007613
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007613, RRID:AB_1078941
Product name
Anti-GALNT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007613
Antibody type
Polyclonal
Antigen
Polypeptide N-acetylgalactosaminyltransferase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQI
GAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQD
SNAPGASGKAFKTTNLSVEEQKEKERGEAKHC
Storage
-20C
Provider Type Product Number
- No reagents -