H00003047-A02

HBG1 antibody from Abnova Corporation
HBG-T2
No application information provided.

Antibody data

Product number
H00003047-A02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003047-A02, RRID:AB_606364
Product name
HBG1 polyclonal antibody (A02)
Provider product page
Abnova Corporation - H00003047-A02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant HBG1.
Antigen sequence
DSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKH
LDDLKGTFAQLSELHCDKLHVDPENFKL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -