H00055065-B01P

SLC52A1 antibody from Abnova Corporation
FLJ10060, GPCR42, GPR172B, hRFT1, PAR2, RFVT1

Antibody data

Product number
H00055065-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055065-B01P, RRID:AB_1573770
Product name
GPR172B purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055065-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human GPR172B protein.
Antigen sequence
MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELP
VVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRR
LAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPV
AGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLP
PPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPA
PTNGTSGPPLDFPERFPASTFFWALTALLVTSAAA
FRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEK
EEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGA
FLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHL
AVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGM
LFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLC
LCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSL
LGAGAMFPPTSIYHVFQSRKDCVDPCGP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -