HPA027309

ZNF232 antibody from Sigma-Aldrich
ZSCAN11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027309
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027309, RRID:AB_10603464
Product name
Anti-ZNF232 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027309
Antibody type
Polyclonal
Antigen
zinc finger protein 232 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SWYEPSAELVQTRMAVSLTAAETLALQGTQGQEKM
MMMGPKEEEQSCEYETRLPGNHSTSQEIFRQRFRH
LRYQETPGPREALSQLRVLCCEWLRPEKHTKEQIL
EFL
Storage
-20C
Provider Type Product Number
- No reagents -