HPA005788

GRAP2 antibody from MilliporeSigma / Merck KGaA
GADS, GRBLG, GrbX, Grf40, Mona
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005788
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005788, RRID:AB_1079021
Product name
Anti-GRAP2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005788
Antibody type
Polyclonal
Antigen
GRB2-related adapter protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGP
HLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQ
PPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLD
INDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRV
RWARALYDFE
Storage
-20C
Provider Type Product Number
- No reagents -