HPA012884

CHST10 antibody from Sigma-Aldrich
HNK-1ST
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012884
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012884, RRID:AB_1846710
Product name
Anti-CHST10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012884
Antibody type
Polyclonal
Antigen
Carbohydrate sulfotransferase 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEVRKLPEEKHIPEELKPTGKELPDSQLVQPLVYM
ERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCD
KHKILFCQTPKVGNTQWKKVLIVLNGAFSSIEEIP
ENVVHDHEKNGLPRLSSFSDAEIQKRL
Storage
-20C
Provider Type Product Number
- No reagents -