Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007178-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007178-M01, RRID:AB_489977
- Product name
- TPT1 monoclonal antibody (M01), clone 3C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TPT1.
- Antigen sequence
GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKL
EEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGE
NMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC- Isotype
- IgG
- Antibody clone number
- 3C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references TCTP increases stability of hypoxia-inducible factor 1α by interaction with and degradation of the tumour suppressor VHL.
Chen K, Chen S, Huang C, Cheng H, Zhou R
Biology of the cell / under the auspices of the European Cell Biology Organization 2013 May;105(5):208-18
Biology of the cell / under the auspices of the European Cell Biology Organization 2013 May;105(5):208-18
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TPT1 monoclonal antibody (M01), clone 3C7 Western Blot analysis of TPT1 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TPT1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TPT1 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol