Antibody data

Product number
H00115827-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00115827-M07, RRID:AB_1579483
Product name
RAB3C monoclonal antibody (M07), clone 1H4
Provider product page
Abnova Corporation - H00115827-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RAB3C.
Antigen sequence
MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLI
IGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK
TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMG
FILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIQ
VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAK
DNINVKQTFERLVDIICDKMSESLETDPAITAAKQ
NTRLKETPPPPQPNCAC
Isotype
IgG
Antibody clone number
1H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -