Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002012-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002012-A01, RRID:AB_462838
- Product name
- EMP1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length recombinant EMP1.
- Antigen sequence
MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVD
ASVGLWKNCTNISCSDSLSYASEDALKTVQAFMIL
SIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVC
WLCILVGVSIYTSHYANRDGTQYHHGYSYILGWIC
FCFSFIIGVLYLVLRKK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The somatostatin analogue octreotide inhibits growth of small intestine neuroendocrine tumour cells.
Epithelial membrane protein 1 inhibits human spinal chondrocyte differentiation.
The expression of EMP1 is downregulated in oral squamous cell carcinoma and possibly associated with tumour metastasis.
Up-regulation of epithelial membrane protein-1 in the temporal neocortex of patients with intractable epilepsy.
Novel markers for differentiation of lobular and ductal invasive breast carcinomas by laser microdissection and microarray analysis.
Li SC, Martijn C, Cui T, Essaghir A, Luque RM, Demoulin JB, Castaño JP, Öberg K, Giandomenico V
PloS one 2012;7(10):e48411
PloS one 2012;7(10):e48411
Epithelial membrane protein 1 inhibits human spinal chondrocyte differentiation.
Li ZY, Xiong SH, Hu M, Zhang CS
Anatomical record (Hoboken, N.J. : 2007) 2011 Jun;294(6):1015-24
Anatomical record (Hoboken, N.J. : 2007) 2011 Jun;294(6):1015-24
The expression of EMP1 is downregulated in oral squamous cell carcinoma and possibly associated with tumour metastasis.
Zhang J, Cao W, Xu Q, Chen WT
Journal of clinical pathology 2011 Jan;64(1):25-9
Journal of clinical pathology 2011 Jan;64(1):25-9
Up-regulation of epithelial membrane protein-1 in the temporal neocortex of patients with intractable epilepsy.
Li YQ, Xue T, Wang L, Xu ZC, Xi ZQ, Yuan J, Wang XF, Chen YM, Zhang M, Yao L
Neurochemical research 2009 Sep;34(9):1594-602
Neurochemical research 2009 Sep;34(9):1594-602
Novel markers for differentiation of lobular and ductal invasive breast carcinomas by laser microdissection and microarray analysis.
Turashvili G, Bouchal J, Baumforth K, Wei W, Dziechciarkova M, Ehrmann J, Klein J, Fridman E, Skarda J, Srovnal J, Hajduch M, Murray P, Kolar Z
BMC cancer 2007 Mar 27;7:55
BMC cancer 2007 Mar 27;7:55
No comments: Submit comment
No validations: Submit validation data