H00002012-A01

EMP1 antibody from Abnova Corporation

CL-20, TMP

No application information provided.

Provider product page for H00002012-A01

Antibody Data

Product number

H00002012-A01

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00002012-A01, RRID:AB_462838

Product name

EMP1 polyclonal antibody (A01)

Provider product page

Antibody type

Polyclonal

Description

Mouse polyclonal antibody raised against a full-length recombinant EMP1.

Antigen sequence

MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVD
ASVGLWKNCTNISCSDSLSYASEDALKTVQAFMIL
SIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVC
WLCILVGVSIYTSHYANRDGTQYHHGYSYILGWIC
FCFSFIIGVLYLVLRKK


Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

The somatostatin analogue octreotide inhibits growth of small intestine neuroendocrine tumour cells.
Li SC, Martijn C, Cui T, Essaghir A, Luque RM, Demoulin JB, Castaño JP, Öberg K, Giandomenico V
PloS one 2012;7(10):e48411

---

Epithelial membrane protein 1 inhibits human spinal chondrocyte differentiation.
Li ZY, Xiong SH, Hu M, Zhang CS
Anatomical record (Hoboken, N.J. : 2007) 2011 Jun;294(6):1015-24

---

The expression of EMP1 is downregulated in oral squamous cell carcinoma and possibly associated with tumour metastasis.
Zhang J, Cao W, Xu Q, Chen WT
Journal of clinical pathology 2011 Jan;64(1):25-9

---

Up-regulation of epithelial membrane protein-1 in the temporal neocortex of patients with intractable epilepsy.
Li YQ, Xue T, Wang L, Xu ZC, Xi ZQ, Yuan J, Wang XF, Chen YM, Zhang M, Yao L
Neurochemical research 2009 Sep;34(9):1594-602

---

Novel markers for differentiation of lobular and ductal invasive breast carcinomas by laser microdissection and microarray analysis.
Turashvili G, Bouchal J, Baumforth K, Wei W, Dziechciarkova M, Ehrmann J, Klein J, Fridman E, Skarda J, Srovnal J, Hajduch M, Murray P, Kolar Z
BMC cancer 2007 Mar 27;7:55