H00002012-A01

EMP1 antibody from Abnova Corporation
CL-20, TMP
No application information provided.

Antibody data

Product number
H00002012-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002012-A01, RRID:AB_462838
Product name
EMP1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00002012-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant EMP1.
Antigen sequence
MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVD
ASVGLWKNCTNISCSDSLSYASEDALKTVQAFMIL
SIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVC
WLCILVGVSIYTSHYANRDGTQYHHGYSYILGWIC
FCFSFIIGVLYLVLRKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.