Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003730-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003730-M01, RRID:AB_489803
- Product name
- KAL1 monoclonal antibody (M01), clone 2E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KAL1.
- Antigen sequence
LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPM
TGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHY
VLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRT
PELPP- Isotype
- IgG
- Antibody clone number
- 2E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Keratinocyte-derived anosmin-1, an extracellular glycoprotein encoded by the X-linked Kallmann syndrome gene, is involved in modulation of epidermal nerve density in atopic dermatitis.
Tengara S, Tominaga M, Kamo A, Taneda K, Negi O, Ogawa H, Takamori K
Journal of dermatological science 2010 Apr;58(1):64-71
Journal of dermatological science 2010 Apr;58(1):64-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KAL1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol