Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003730-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003730-A01, RRID:AB_462406
- Product name
- KAL1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant KAL1.
- Antigen sequence
LAKPENLSASFIVQDVNITGHFSWKMAKANLYQPM
TGFQVTWAEVTTESRQNSLPNSIISQSQILPSDHY
VLTVPNLRPSTLYRLEVQVLTPGGEGPATIKTFRT
PELPP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Kallmann syndrome 1 gene is expressed in the marsupial gonad.
Hu Y, Yu H, Shaw G, Pask AJ, Renfree MB
Biology of reproduction 2011 Mar;84(3):595-603
Biology of reproduction 2011 Mar;84(3):595-603
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- KAL1 polyclonal antibody (A01), Lot # ABNOVA060629QCS1 Western Blot analysis of KAL1 expression in Hela S3 NE ( Cat # L013V3 ).