HPA015485

IL1RL2 antibody from Sigma-Aldrich
IL1R-rp2, IL1RRP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015485
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015485, RRID:AB_1851612
Product name
Anti-IL1RL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015485
Antibody type
Polyclonal
Antigen
Interleukin-1 receptor-like 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QAILTHSGKQYEVLNGITVSITERAGYGGSVPKII
YPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRV
NNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
TFLEVKMEDYGLPFMCHAG
Storage
-20C
Provider Type Product Number
- No reagents -