Antibody data

Product number
ABIN405461
Provider
antibodies-online
Product name
anti-Pre-B Lymphocyte 1 (VPREB1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405461
Antibody type
Polyclonal
Antigen
The immunogen for anti-VPREB1 antibody: synthetic peptide directed towards the middle region of human VPREB1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
Host
Rabbit
Antigen sequence
TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLR
YFSQS DKSQGPQVPP
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -