HPA007406

IL1RL1 antibody from Atlas Antibodies
DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007406
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007406, RRID:AB_1079128
Product name
Anti-IL1RL1
Provider product page
Atlas Antibodies - HPA007406
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRK
SRRHIFILTPQITHNKEFAYEQEVALHCALIQNDA
KVILIEMEALSELDMLQAEALQDSLQHLMKVQGTI
KWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKA
SSLTPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -