HPA007917

IL1RL1 antibody from Sigma-Aldrich
DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007917
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007917, RRID:AB_1079129
Product name
Anti-IL1RL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007917
Antibody type
Polyclonal
Antigen
Interleukin-1 receptor-like 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLP
AAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDC
NVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLE
WFKNCQALQGSRY
Storage
-20C
Provider Type Product Number
- No reagents -