H00129025-B01

ZNF280A antibody from Abnova Corporation
3'OY11.1, SUHW1, ZNF280, ZNF636

Antibody data

Product number
H00129025-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00129025-B01, RRID:AB_1018734
Product name
SUHW1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00129025-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SUHW1 protein.
Antigen sequence
MGDIFLCKKVESPKKNLRESKQREEDDEDPDLIYV
GVEHVHRDAEVLFVGMISNSKPVVSNILNRVTPGS
NSRRKKGHFRQYPAHVSQPANHVTSMAKAIMPVSL
SEGRSTDSPVTMKSSSEPGYKMSSPQVVSPSSSDS
LPPGTQCLVGAMVSGGGRNESSPDSKRLSTSDINS
RDSKRVKLRDGIPGVPSLAVVPSDMSSTISTNTPS
QGICNSSNHVQNGVTFPWPDANGKAHFNLTDPERA
SESALAMTDISSLASQNKTFDPKKENPIVLLSDFY
YGQHKGDGQPEQKTHTTFKCLSCVKVLKNIKFMNH
MKHHLEFEKQRNDSWEDHTTCQHCHRQFPTPFQLQ
CHIDSVHIAMGPSAVCKICELSFETDQVLLQHMKD
HHKPGEMPYVCQVCHYRSSVFADVETHFRTCHENT
KNLLCLFCLKLFKTAIPYMNHCWRHSRRRVLQCSK
CRLQFLTLKEEIEHKTKDHQTFKKPEQLQGLPSET
KVIIQTSVQPGSSGMASVIVSNTDPQSSPVKTKKK
TAMNTRDSRLPCSKDSS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.