HPA007615

IL18R1 antibody from Atlas Antibodies
CD218a, IL-1Rrp, IL1RRP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007615
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007615, RRID:AB_1851675
Product name
Anti-IL18R1
Provider product page
Atlas Antibodies - HPA007615
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHV
AVELGKNVRLNCSALLNEEDVIYWMFGEENGSDPN
IHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVL
YNCTVASTGGTDTKSFILVRKA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -