HPA007615

IL18R1 antibody from Sigma-Aldrich
CD218a, IL-1Rrp, IL1RRP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007615
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007615, RRID:AB_1851675
Product name
Anti-IL18R1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007615
Antibody type
Polyclonal
Antigen
Interleukin-18 receptor 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHV
AVELGKNVRLNCSALLNEEDVIYWMFGEENGSDPN
IHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVL
YNCTVASTGGTDTKSFILVRKA
Storage
-20C
Provider Type Product Number
- No reagents -