Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038255 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-DEPDC1B
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GKWGEEDFEDNRHLYRFPPSSPLKPYPKKPPNQKD
VIKFPEWNDLPPGTSQENIPVRPVVMNSEMWYKRH
SI- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references DEPDC1B is a key regulator of myoblast proliferation in mouse and man
The long noncoding RNA lncNB1 promotes tumorigenesis by interacting with ribosomal protein RPL35
Figeac N, Pruller J, Hofer I, Fortier M, Ortuste Quiroga H, Banerji C, Zammit P
Cell Proliferation 2019;53(1)
Cell Proliferation 2019;53(1)
The long noncoding RNA lncNB1 promotes tumorigenesis by interacting with ribosomal protein RPL35
Liu P, Tee A, Milazzo G, Hannan K, Maag J, Mondal S, Atmadibrata B, Bartonicek N, Peng H, Ho N, Mayoh C, Ciaccio R, Sun Y, Henderson M, Gao J, Everaert C, Hulme A, Wong M, Lan Q, Cheung B, Shi L, Wang J, Simon T, Fischer M, Zhang X, Marshall G, Norris M, Haber M, Vandesompele J, Li J, Mestdagh P, Hannan R, Dinger M, Perini G, Liu T
Nature Communications 2019;10(1)
Nature Communications 2019;10(1)
No comments: Submit comment
No validations: Submit validation data