Antibody data

Product number
H00055789-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055789-M01, RRID:AB_1112544
Product name
DEPDC1B monoclonal antibody (M01), clone 2H2
Provider product page
Abnova Corporation - H00055789-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DEPDC1B.
Antigen sequence
SFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAK
LSNKEKKKKLKQFQKSYPEVYQERFPTPESAALLF
PEKPKPKPQLLMWALKKPFQPFQRTRSFRM
Isotype
IgG
Antibody clone number
2H2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -