Antibody data

Product number
HPA072558
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA072558, RRID:AB_2686534
Product name
Anti-DEPDC1B
Provider product page
Atlas Antibodies - HPA072558
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKI
LGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVIL
DDKSKELPHW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -