SAB1401871

COG3 antibody from MilliporeSigma / Merck KGaA
SEC34
ELISA
Recommended by provider

Antibody data

Product number
SAB1401871
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1401871, RRID:AB_10609425
Product name
Monoclonal Anti-COG3 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1401871
Antibody type
Monoclonal
Antigen
COG3 (NP_113619, 25 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse
Antigen sequence
WDRRPDTTAPLTDRQTDSVLELKAAAENLPVPAEL
PIEDLCSLTSQSLPIELTSVVPESTEDILLKGFTS
LGMEEERIETAQQFFSWFAKLQTQMDQDEG*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -