HPA040303

PLBD1 antibody from Atlas Antibodies
FLJ22662
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA040303
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA040303, RRID:AB_2676922
Product name
Anti-PLBD1
Provider product page
Atlas Antibodies - HPA040303
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WMPAEKTVQVKNVMDKNGDAYGFYNNSVKTTGWGI
LEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMND
HYTNLYPQLITKPSIMDKVQDFMEKQD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -