Antibody data

Product number
H00007173-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007173-M08, RRID:AB_1137506
Product name
TPO monoclonal antibody (M08), clone 2A11
Provider product page
Abnova Corporation - H00007173-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TPO.
Antigen sequence
WENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPM
DAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDK
CGFPESVENGDFVHCEESGRRVLVYSCRHGYELQG
REQ
Isotype
IgG
Antibody clone number
2A11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -