HPA007987

TPO antibody from Sigma-Aldrich
TPX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007987
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007987, RRID:AB_1080270
Product name
Anti-TPO antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007987
Antibody type
Polyclonal
Antigen
Thyroid peroxidase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDF
ESCDSITGMNLEAWRETFPQDDKCGFPESVENGDF
VHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWD
FQPPLCKDVNECADGA
Storage
-20C
Provider Type Product Number
- No reagents -