WH0011183M1

MAP4K5 antibody from MilliporeSigma / Merck KGaA
GCKR, KHS, KHS1
ELISA
Recommended by provider

Antibody data

Product number
WH0011183M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0011183M1, RRID:AB_1842430
Product name
Monoclonal Anti-MAP4K5 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0011183M1
Antibody type
Monoclonal
Antigen
MAP4K5 (AAH36013, a.a. 361-470) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SSDPNFMLQWNPFVDGANTGKSTSKRAIPPPLPPK
PRISSYPEDNFPDEEKASTIKHCPDSESRAPQILR
RQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQ
APQLP (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -