Antibody data

Product number
H00011183-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011183-M01, RRID:AB_463789
Product name
MAP4K5 monoclonal antibody (M01), clone 3H3
Provider product page
Abnova Corporation - H00011183-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAP4K5.
Antigen sequence
SSDPNFMLQWNPFVDGANTGKSTSKRAIPPPLPPK
PRISSYPEDNFPDEEKASTIKHCPDSESRAPQILR
RQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQ
APQLP
Isotype
IgG
Antibody clone number
3H3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -