Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB30532 - Provider product page

- Provider
- Abnova Corporation
- Product name
- MAP4K5 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human MAP4K5.
- Antigen sequence
YPEDNFPDEEKASTIKHCPDSESRAPQILRRQSSP
SCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLP
RKKDKRDFPKPA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot (Cell lysate) analysis with MAP4K5 polyclonal antibody (Cat # PAB30532)Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)