Antibody data

Product number
PAB30532
Provider
Abnova Corporation
Product name
MAP4K5 polyclonal antibody
Provider product page
Abnova Corporation - PAB30532
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant human MAP4K5.
Antigen sequence
YPEDNFPDEEKASTIKHCPDSESRAPQILRRQSSP
SCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLP
RKKDKRDFPKPA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -