HPA007408

LCT antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007408
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007408, RRID:AB_1079222
Product name
Anti-LCT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007408
Antibody type
Polyclonal
Antigen
Lactase-phlorizin hydrolase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KELPHQESRASQLQTLSDAHRKAYEIYHESYAFQG
GKLSVVLRAEDIPELLLEPPISALAQDTVDFLSLD
LSYECQNEASLRQKLSKLQTIEPKVKVFIFNLKLP
DCPSTMKNPASLLFSLFEAINKDQVLTIGFDINEF
LSCSSSSKK
Storage
-20C
Provider Type Product Number
- No reagents -