SAB2102140

SHROOM2 antibody from Sigma-Aldrich
APXL
No application information provided.

Antibody data

Product number
SAB2102140
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102140, RRID:AB_10605302
Product name
Anti-SHROOM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102140
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001640.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSL
ADILDPSVKIKTTMD
Storage
-20C
Provider Type Product Number
- No reagents -