H00121504-A01

H4-16 antibody from Abnova Corporation
HIST4H4, MGC24116
No application information provided.

Antibody data

Product number
H00121504-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00121504-A01, RRID:AB_1139206
Product name
HIST4H4 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00121504-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant HIST4H4.
Antigen sequence
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAI
RRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -