HPA011216

CD207 antibody from Atlas Antibodies
CLEC4K, Langerin

Antibody data

Product number
HPA011216
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011216, RRID:AB_1078453
Product name
Anti-CD207
Provider product page
Atlas Antibodies - HPA011216
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQ
IQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRS
WEEVSTLNAQIPELKSDLEKASALNTKIRALQGSL
ENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.