HPA011216

CD207 antibody from Sigma-Aldrich
CLEC4K, Langerin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011216
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011216, RRID:AB_1078453
Product name
Anti-CD207 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011216
Antibody type
Polyclonal
Antigen
C-type lectin domain family 4 member K recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQ
IQMVNESLGYVRSQFLKLKTSVEKANAEIQILTRS
WEEVSTLNAQIPELKSDLEKASALNTKIRALQGSL
ENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIP
Storage
-20C
Provider Type Product Number
- No reagents -