HPA022478

RPAIN antibody from Sigma-Aldrich
hRIP, MGC4189, RIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022478
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022478, RRID:AB_10600325
Product name
Anti-RPAIN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022478
Antibody type
Polyclonal
Antigen
RPA interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQSVENCPEDLAQLEELIDMAVLEEIQQELINQEQ
SIISEYEKSLQFDEKCLSIMLAEWEANPLICPVCT
K
Storage
-20C
Provider Type Product Number
- No reagents -