HPA008119

C3orf52 antibody from Sigma-Aldrich
FLJ23186, TTMP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008119
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008119, RRID:AB_1848824
Product name
Anti-C3orf52 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008119
Antibody type
Polyclonal
Antigen
TPA-induced transmembrane protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQPSQPVDELELSVLERQPEENTPLNGADKVFPSL
DEEVPPAEANKESPWSSCNKNVVGRCK
Storage
-20C
Provider Type Product Number
- No reagents -