WH0051062M3

ATL1 antibody from Sigma-Aldrich
AD-FSP, FSP1, SPG3, SPG3A
ELISA
Recommended by provider

Antibody data

Product number
WH0051062M3
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0051062M3, RRID:AB_1843737
Product name
Monoclonal Anti-SPG3A antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0051062M3
Antibody type
Monoclonal
Antigen
SPG3A (NP_056999, a.a. 1-101) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPV
QVLIVKDDHSFELDETALNRILLSEAVRDKEVVAV
SVAGAFRKGKSFLMDFMLRYMYNQESVDWV* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -