HPA027550

ATL1 antibody from Sigma-Aldrich
AD-FSP, FSP1, SPG3, SPG3A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027550
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027550, RRID:AB_10600983
Product name
Anti-ATL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027550
Antibody type
Polyclonal
Antigen
atlastin GTPase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKI
YQGEELPHPKSMLQATAEANNLAAVATAKDTYNKK
MEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGV
KKMGGEEFSRRYLQQLESE
Storage
-20C
Provider Type Product Number
- No reagents -