HPA007499

PLXNA1 antibody from Sigma-Aldrich
NOV, PLXN1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007499
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007499, RRID:AB_1079637
Product name
Anti-PLXNA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007499
Antibody type
Polyclonal
Antigen
Plexin-A1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDFNQPLGGTVTIEGTPLFVDKDDGLTAVAAYDYR
GRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESV
VAQEGSPILRDLVLSPNHQYLYAMTEKQVT
Storage
-20C
Provider Type Product Number
- No reagents -