HPA030924

C2CD2 antibody from Atlas Antibodies
C21orf25, C21orf258, DKFZP586F0422, TMEM24L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA030924
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA030924, RRID:AB_10669873
Product name
Anti-C2CD2
Provider product page
Atlas Antibodies - HPA030924
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AKSKELHLQISEAGRSSEGLLATATVPLDLFKKQP
SGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELK
SWPIP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -