H00025966-B01

C2CD2 antibody from Abnova Corporation
C21orf25, C21orf258, DKFZP586F0422, TMEM24L

Antibody data

Product number
H00025966-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025966-B01, RRID:AB_1017387
Product name
C21orf25 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00025966-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C21orf25 protein.
Antigen sequence
MRLSPFHLQLEFHMKEKREDLQISWSFISVPEMAV
NIQPKALGEDQVAETSAMSDVLKDILKHLAGSASP
SVVLITKPTTVKEAQNLQCAASTAQESCPPKPPRA
HELKLLVRNIHVLLLSEPGASGHINAVCVVQLNDP
VQRFSSTLTKNTPDLMWEEEFTFELNAKSKELHLQ
ISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLT
SGSACGSSVLGSVTAEFSYMEPGELKSWPIPPPVP
AAKIEKDRTVMPCGTVVTTVTAVKTKPRVDVGRAS
PLSSDSPVKTPIKVKVIEKDISVQAIACRSAPVSK
TLSSSDTELLVLNGSDPVAEVAIRQLSESSKLKLK
SPRKKSTIIISGISKVPSWWLGRCSSGHLSVTCCS
SAL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -