Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010921-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010921-M05, RRID:AB_1112420
- Product name
- RNPS1 monoclonal antibody (M05), clone 7G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RNPS1.
- Antigen sequence
PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDM
PVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQ
IDGQEITATAVL- Isotype
- IgG
- Antibody clone number
- 7G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Global tumor protein p53/p63 interactome: making a case for cisplatin chemoresistance.
Huang Y, Jeong JS, Okamura J, Sook-Kim M, Zhu H, Guerrero-Preston R, Ratovitski EA
Cell cycle (Georgetown, Tex.) 2012 Jun 15;11(12):2367-79
Cell cycle (Georgetown, Tex.) 2012 Jun 15;11(12):2367-79
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RNPS1 monoclonal antibody (M05), clone 7G8. Western Blot analysis of RNPS1 expression in rat testis.