H00000420-B01

ART4 antibody from Abnova Corporation
ARTC4, CD297, DO, DOK1

Antibody data

Product number
H00000420-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000420-B01, RRID:AB_1137776
Product name
ART4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00000420-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ART4 protein.
Antigen sequence
MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLL
LLSGLQRPTEGSEVAIKIDFDFAPGSFDDQYQGCS
KQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWL
NQGKVLPQNMTTTHAVAILFYTLNSNVHSDFTRAM
ASVARTPQQYERSFHFKYLHYYLTSAIQLLRKDSI
MENGTLCYEVHYRTKDVHFNAYTGATIRFGQFLST
SLLKEEAQEFGNQTLFTIFTCLGAPVQYFSLKKEV
LIPPYELFKVINMSYHPRGDWLQLRSTGNLSTYNC
QLLKASSKKCIPDPIAIASLSFLTSVIIFSKSRV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.